PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_632EBAD09.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 193aa    MW: 20973.9 Da    PI: 10.0645
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_632EBAD09.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd+ lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Traes_5BL_632EBAD09.1 14 KGPWTPEEDLMLVSYIQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding48.71.8e-1567112148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++  +E++l+v++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Traes_5BL_632EBAD09.1  67 RGNFNDQEEKLIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                            899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-24563IPR009057Homeodomain-like
PROSITE profilePS5129424.339965IPR017930Myb domain
SuperFamilySSF466897.03E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-131363IPR001005SANT/Myb domain
PfamPF002492.2E-161461IPR001005SANT/Myb domain
CDDcd001673.15E-111661No hitNo description
Gene3DG3DSA:1.10.10.609.2E-2464117IPR009057Homeodomain-like
PROSITE profilePS5129419.34566116IPR017930Myb domain
SMARTSM007172.8E-1566114IPR001005SANT/Myb domain
PfamPF002493.6E-1467112IPR001005SANT/Myb domain
CDDcd001671.58E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0010468Biological Processregulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYIQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF NDQEEKLIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ  120
DAGGNDGGSE GAGAAGVGGG VAKAAAPKGQ WERRLQTDIH TARQALRDAL SLEPSQPAAL  180
AAPALPTPPG SVT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-26141164105MYB PROTO-ONCOGENE PROTEIN
1h8a_C5e-261211625128MYB TRANSFORMING PROTEIN
1mse_C3e-26141164105C-Myb DNA-Binding Domain
1msf_C3e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAPTransfer from AT5G62470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519140.0JF951914.1 Aegilops tauschii clone TaMYB31 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652703.11e-104PREDICTED: myb-related protein 306-like
SwissprotP813923e-95MYB06_ANTMA; Myb-related protein 306
TrEMBLW5FCA61e-142W5FCA6_WHEAT; Uncharacterized protein
STRINGMLOC_34885.11e-123(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-88myb domain protein 94
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]